Sequence manipulation and scanning

Introduction

This vignette goes through generating your own sequences from a specified background model, shuffling sequences whilst maintaining a certain k-let size, and the scanning of sequences and scoring of motifs. For an introduction to sequence motifs, see the introductory vignette. For a basic overview of available motif-related functions, see the motif manipulation vignette. For a discussion on motif comparisons and P-values, see the motif comparisons and P-values vignette.

Basic sequence handling

Creating random sequences

The Biostrings package offers an excellent suite of functions for dealing with biological sequences. The universalmotif package hopes to help extend these by providing the create_sequences() and shuffle_sequences() functions. The first of these, create_sequences(), generates a set of letters in random order, then passes these strings to the Biostrings package to generate the final XStringSet object. The number and length of sequences can be specified. The probabilities of individual letters can also be set.

The freqs option of create_sequences() also takes higher order backgrounds. In these cases the sequences are constructed in a Markov-style manner, where the probability of each letter is based on which letters precede it.

library(universalmotif)
library(Biostrings)

## Create some DNA sequences for use with an external program (default
## is DNA):

sequences.dna <- create_sequences(seqnum = 500,
                                  freqs = c(A=0.3, C=0.2, G=0.2, T=0.3))
## writeXStringSet(sequences.dna, "dna.fasta")
sequences.dna
#> DNAStringSet object of length 500:
#>       width seq
#>   [1]   100 GTATGTGGATCTATATTAAGGTCGTTATCATAT...ATCATATATTGACGCAAGCGATACGGTCGAGA
#>   [2]   100 CCGAAGTATCATCGCGTTTCCATATCCGAGCGT...TCTGTCTGGGGACGAACTTTTTAAGTGGTCCG
#>   [3]   100 GGGTGGTGACAGGCGTCCGAGAGGCTATCTCGA...TTATAACGCTGTTCATCACTGTCATCATTATA
#>   [4]   100 TTTTCCCGTCCACGTACTACAGTCTGTAACCCC...TTAGTGAGGCCATCATGGTAGACTTGAGAGCA
#>   [5]   100 CTTCTTCCTAATAACATGAGATACGAAGAAAAT...GTAAATTGGCCCATCAAATTCTGTAGAATTGT
#>   ...   ... ...
#> [496]   100 GCTTCGTTTGGCGAACGGGCTAGGAAAAATTGG...AAGTTGACTAAAACGACTGACATGGGATATAG
#> [497]   100 CAGAGCACCGTAAAATTCTACTACCACAAGTTG...TTAACCTATGAATAGAATAACACAATTACATA
#> [498]   100 AGATAGTTAAATGCTATGTCCAAAGACCGTGGT...CTCCCAAGGAAACGGGATTGTATTCCGAGATC
#> [499]   100 AGAACAAAAAATCTGTAGTTGTTCGGCAGCTTC...CGATTAGCGACATTGCCTGACAACCAGGCTCT
#> [500]   100 AAATATTCAAACCCTACTAGATTTCCTACGCCT...CAACTATGGACTAGTTTGCTTACCAGACTATT

## Amino acid:

create_sequences(alphabet = "AA")
#> AAStringSet object of length 100:
#>       width seq
#>   [1]   100 RDSNYWCIVFNNRVVNPAPVGKITWGCYLNGYP...YEKRAMHISSFGRWQWRYKHEKEFWASGFLVH
#>   [2]   100 EDHGDTWNDEDMCLPMNYDDQHCYWKKCKMSCA...LPITDFEGERRWMLNGGHPVYKKFAVRMFKWY
#>   [3]   100 QDSDTVGRFIGAHLYEDNMFWWRKTTRYWCIAV...NQFCIGPDWIGALDRFRVADVPWHKCKSGCFC
#>   [4]   100 HGCIWRPDERPGYTMCGNMSSYVNYRSKKEDWS...DQTQATTALKSFFIFMYQFPIAKKGVTTWNGL
#>   [5]   100 RLQYGRIISKTNPENYFTQIDIKWSVEYPNPTP...YCGTAHMCDDGWVFFPRPVTAKIMCPWEGSDP
#>   ...   ... ...
#>  [96]   100 KVYRLCHRILAWMTLMKLKYVEKIDRQTFTVGE...KNCYVRAETGVCNEGGYSFLEDEFWMHYVMDK
#>  [97]   100 NEPRTQMNSCFFSWAICMLWNMYQHQHQTFGDA...FWSIQSYECNLRLPDNLIPYMMKDWQAVKTYT
#>  [98]   100 NKRVNGVIGSPQYIHPHSPTHMTKSSQRKWLLN...FWRNNLTLKHKASFRFNYSNGDLAKVSACNGQ
#>  [99]   100 CVNYSTIKNKSWSHITPLTFEVLLILWNSMWDP...WPDMAYTPCQYIYEPQVSMRYIQKPPACAMCN
#> [100]   100 ADYVRFIVMGNAMVGATPYVAMFRQTADDQDPA...GCVRSCSDKWEVLRAPGMIIGSGNFHQEKAYI

## Any set of characters can be used

create_sequences(alphabet = paste0(letters, collapse = ""))
#> BStringSet object of length 100:
#>       width seq
#>   [1]   100 piksnregdntagkrjtllthhtqsawpwfoqu...orveeufymjkoiiqwhwhqpturgbzqaxnl
#>   [2]   100 spxaejefuuswhzeftpeeankklblesgrng...fshvmfotiuwdcmetktbvmbbsljmzegfq
#>   [3]   100 nrtnmityzypxralitimkxwiegjjxoezfp...apiebdgfzuhhgdigvwakaazismywkxzl
#>   [4]   100 nyxidkrdvbpvjtlmocoklknnarsvfoice...ncaocsfqgzwqynxsnlicbuklgdhuhgor
#>   [5]   100 sietfbkvbbqroqkzgfhnogmtvkreildpl...abjmrkeiuhhsghjdlqmyzmcwokkfhkao
#>   ...   ... ...
#>  [96]   100 hkacacztagtoxccycavtngyospjjvghph...yigtqpjgjpoflykuewhejpklizdsgonm
#>  [97]   100 sazknuexmdsnasvkcqbwgclgrzhziumvz...fghcieruvfdvybbvwpmrzqdzwfzmyuud
#>  [98]   100 bzyewtatoarshftzyebugrkaiyrqttick...tywyvfywzgthhwaqlyaqojcfpihbeskv
#>  [99]   100 xbewtzrpekflmiqyqieaicagejcdagepi...ddybajfrokrtzbgrwwyzrsxydyarsvze
#> [100]   100 taagjwtqmfyguocyzikltqauxmularhku...vualavcxjpmldmtqbkkjyxzoctycbbuq

Calculating sequence background

Sequence backgrounds can be retrieved for DNA and RNA sequences with oligonucleotideFrequency() from "Biostrings. Unfortunately, no such Biostrings function exists for other sequence alphabets. The universalmotif package proves get_bkg() to remedy this. Similarly, the get_bkg() function can calculate higher order backgrounds for any alphabet as well. It is recommended to use the original Biostrings for very long (e.g. billions of characters) DNA and RNA sequences whenever possible though, as it is much faster than get_bkg().

library(universalmotif)

## Background of DNA sequences:
dna <- create_sequences()
get_bkg(dna, k = 1:2)
#> DataFrame with 20 rows and 3 columns
#>            klet     count probability
#>     <character> <numeric>   <numeric>
#> 1             A      2528   0.2528000
#> 2             C      2513   0.2513000
#> 3             G      2472   0.2472000
#> 4             T      2487   0.2487000
#> 5            AA       647   0.0653535
#> ...         ...       ...         ...
#> 16           GT       618   0.0624242
#> 17           TA       601   0.0607071
#> 18           TC       629   0.0635354
#> 19           TG       620   0.0626263
#> 20           TT       615   0.0621212

## Background of non DNA/RNA sequences:
qwerty <- create_sequences("QWERTY")
get_bkg(qwerty, k = 1:2)
#> DataFrame with 42 rows and 3 columns
#>            klet     count probability
#>     <character> <numeric>   <numeric>
#> 1             E      1676      0.1676
#> 2             Q      1642      0.1642
#> 3             R      1647      0.1647
#> 4             T      1637      0.1637
#> 5             W      1690      0.1690
#> ...         ...       ...         ...
#> 38           YQ       292   0.0294949
#> 39           YR       272   0.0274747
#> 40           YT       288   0.0290909
#> 41           YW       281   0.0283838
#> 42           YY       268   0.0270707

Clustering sequences by k-let composition

One way to compare sequences is by k-let composition. The following example illustrates how one could go about doing this using only the universalmotif package and base graphics.

library(universalmotif)

## Generate three random sets of sequences:
s1 <- create_sequences(seqnum = 20,
  freqs = c(A = 0.3, C = 0.2, G = 0.2, T = 0.3))
s2 <- create_sequences(seqnum = 20,
  freqs = c(A = 0.4, C = 0.4, G = 0.1, T = 0.1))
s3 <- create_sequences(seqnum = 20,
  freqs = c(A = 0.2, C = 0.3, G = 0.3, T = 0.2))

## Create a function to get properly formatted k-let counts:
get_klet_matrix <- function(seqs, k, groupName) {
  bkg <- get_bkg(seqs, k = k, merge.res = FALSE)
  bkg <- bkg[, c("sequence", "klet", "count")]
  bkg <- reshape(bkg, idvar = "sequence", timevar = "klet",
    direction = "wide")
  suppressWarnings(as.data.frame(cbind(Group = groupName, bkg)))
}

## Calculate k-let content (up to you what size k you want!):
s1 <- get_klet_matrix(s1, 4, 1)
s2 <- get_klet_matrix(s2, 4, 2)
s3 <- get_klet_matrix(s3, 4, 3)

# Combine everything into a single object:
sAll <- rbind(s1, s2, s3)

## Do the PCA:
sPCA <- prcomp(sAll[, -(1:2)])

## Plot the PCA:
plot(sPCA$x, col = c("red", "forestgreen", "blue")[sAll$Group], pch = 19)

This example could be improved by using tidyr::spread() instead of reshape() (the former is much faster), and plotting the PCA using the ggfortify package to create a nicer ggplot2 plot. Feel free to play around with different ways of plotting the data! Additionally, you could even try using t-SNE instead of PCA (such as via the Rtsne package).

Shuffling

Shuffling sequences

When performing de novo motif searches or motif enrichment analyses, it is common to do so against a set of background sequences. In order to properly identify consistent patterns or motifs in the target sequences, it is important that there be maintained a certain level of sequence composition between the target and background sequences. This reduces results which are derived purely from base differential letter frequency biases.

In order to avoid these results, typically it desirable to use a set of background sequences which preserve a certain k-let size (such as dinucleotide or trinucleotide frequencies in the case of DNA sequences). Though for some cases a set of similar sequences may already be available for use as background sequences, usually background sequences are obtained by shuffling the target sequences, while preserving a desired k-let size. For this purpose, a commonly used tool is uShuffle (Jiang et al. 2008). The universalmotif package aims to provide its own k-let shuffling capabilities for use within R via shuffle_sequences().

The universalmotif package offers three different methods for sequence shuffling: euler, markov and linear. The first method, euler, can shuffle sequences while preserving any desired k-let size. Furthermore 1-letter counts will always be maintained. However due to the nature of the method, the first and last letters will remain unshuffled. This method is based on the initial random Eulerian walk algorithm proposed by Altschul and Erickson (1985) and the subsequent cycle-popping algorithm detailed by Propp and Wilson (1998) for quickly and efficiently finding Eulerian walks.

The second method, markov can only guarantee that the approximate k-let frequency will be maintained, but not that the original letter counts will be preserved. The markov method involves determining the original k-let frequencies, then creating a new set of sequences which will have approximately similar k-let frequency. As a result the counts for the individual letters will likely be different. Essentially, it involves a combination of determining k-let frequencies followed by create_sequences(). This type of pseudo-shuffling is discussed by Fitch (1983).

The third method linear preserves the original 1-letter counts exactly, but uses a more crude shuffling technique. In this case the sequence is split into sub-sequences every k-let (of any size), which are then re-assembled randomly. This means that while shuffling the same sequence multiple times with method = "linear" will result in different sequences, they will all have started from the same set of k-length sub-sequences (just re-assembled differently).

library(universalmotif)
library(Biostrings)
data(ArabidopsisPromoters)

## Potentially starting off with some external sequences:
# ArabidopsisPromoters <- readDNAStringSet("ArabidopsisPromoters.fasta")

euler <- shuffle_sequences(ArabidopsisPromoters, k = 2, method = "euler")
markov <- shuffle_sequences(ArabidopsisPromoters, k = 2, method = "markov")
linear <- shuffle_sequences(ArabidopsisPromoters, k = 2, method = "linear")
k1 <- shuffle_sequences(ArabidopsisPromoters, k = 1)

Let us compare how the methods perform:

o.letter <- get_bkg(ArabidopsisPromoters, 1)
e.letter <- get_bkg(euler, 1)
m.letter <- get_bkg(markov, 1)
l.letter <- get_bkg(linear, 1)

data.frame(original=o.letter$count, euler=e.letter$count,
  markov=m.letter$count, linear=l.letter$count, row.names = DNA_BASES)
#>   original euler markov linear
#> A    17384 17384  17517  17384
#> C     8081  8081   8065   8081
#> G     7583  7583   7532   7583
#> T    16952 16952  16886  16952

o.counts <- get_bkg(ArabidopsisPromoters, 2)
e.counts <- get_bkg(euler, 2)
m.counts <- get_bkg(markov, 2)
l.counts <- get_bkg(linear, 2)

data.frame(original=o.counts$count, euler=e.counts$count,
  markov=m.counts$count, linear=l.counts$count,
  row.names = get_klets(DNA_BASES, 2))
#>    original euler markov linear
#> AA     6893  6893   6218   6551
#> AC     2614  2614   2791   2671
#> AG     2592  2592   2557   2593
#> AT     5276  5276   5930   5551
#> CA     3014  3014   2816   2947
#> CC     1376  1376   1350   1334
#> CG     1051  1051   1256   1118
#> CT     2621  2621   2639   2674
#> GA     2734  2734   2622   2647
#> GC     1104  1104   1222   1169
#> GG     1176  1176   1179   1205
#> GT     2561  2561   2506   2555
#> TA     4725  4725   5848   5223
#> TC     2977  2977   2691   2896
#> TG     2759  2759   2532   2655
#> TT     6477  6477   5793   6161

Local shuffling

If you have a fairly heterogeneous sequence and wish to preserve the presence of local “patches” of differential sequence composition, you can set window = TRUE in the shuffle_sequences() function. In the following example, the sequence of interest has an AT rich first half followed by a second half with an even background. The impact on this specific sequence composition is observed after regular and local shuffling, using the per-window functionality of get_bkg() (via window = TRUE). Fine-tune the window size and overlap between windows with window.size and window.overlap.

library(Biostrings)
library(universalmotif)
library(ggplot2)

myseq <- DNAStringSet(paste0(
  create_sequences(seqlen = 500, freqs = c(A=0.4, T=0.4, C=0.1, G=0.1)),
  create_sequences(seqlen = 500)
))

myseq_shuf <- shuffle_sequences(myseq)
myseq_shuf_local <- shuffle_sequences(myseq, window = TRUE)

myseq_bkg <- get_bkg(myseq, k = 1, window = TRUE)
myseq_shuf_bkg <- get_bkg(myseq_shuf, k = 1, window = TRUE)
myseq_shuf_local_bkg <- get_bkg(myseq_shuf_local, k = 1, window = TRUE)

myseq_bkg$group <- "original"
myseq_shuf_bkg$group <- "shuffled"
myseq_shuf_local_bkg$group <- "shuffled-local"

myseq_all <- suppressWarnings(as.data.frame(
  rbind(myseq_bkg, myseq_shuf_bkg, myseq_shuf_local_bkg)
))

ggplot(myseq_all, aes(x = start, y = probability, colour = klet)) +
  geom_line() +
  theme_minimal() +
  scale_colour_manual(values = universalmotif:::DNA_COLOURS) +
  xlab(element_blank()) +
  facet_wrap(~group, ncol = 1)
#> Warning: `label` cannot be a <ggplot2::element_blank> object.

Sequence scanning and enrichment

There are many motif-programs available with sequence scanning capabilities, such as HOMER and tools from the MEME suite. The universalmotif package does not aim to supplant these, but rather provide convenience functions for quickly scanning a few sequences without needing to leave the R environment. Furthermore, these functions allow for taking advantage of the higher-order (multifreq) motif format described here.

Two scanning-related functions are provided: scan_sequences() and enrich_motifs(). The latter simply runs scan_sequences() twice on a set of target and background sequences. Given a motif of length n, scan_sequences() considers every possible n-length subset in a sequence and scores it using the PWM format. If the match surpasses the minimum threshold, it is reported. This is case regardless of whether one is scanning with a regular motif, or using the higher-order (multifreq) motif format (the multifreq matrix is converted to a PWM).

Choosing a logodds threshold

Before scanning a set of sequences, one must first decide the minimum logodds threshold for retrieving matches. This decision is not always the same between scanning programs out in the wild, nor is it usually told to the user what the cutoff is or how it is decided. As a result, universalmotif aims to be as transparent as possible in this regard by allowing for complete control of the threshold. For more details on PWMs, see the introductory vignette.

Logodds thresholds

One way is to set a cutoff between 0 and 1, then multiplying the highest possible PWM score to get a threshold. The matchPWM() function from the Biostrings package for example uses a default of 0.8 (shown as "80%"). This is quite arbitrary of course, and every motif will end up with a different threshold. For high information content motifs, there is really no right or wrong threshold, as they tend to have fewer non-specific positions. This means that incorrect letters in a match will be more punishing. To illustrate this, contrast the following PWMs:

library(universalmotif)
m1 <- create_motif("TATATATATA", nsites = 50, type = "PWM", pseudocount = 1)
m2 <- matrix(c(0.10,0.27,0.23,0.19,0.29,0.28,0.51,0.12,0.34,0.26,
               0.36,0.29,0.51,0.38,0.23,0.16,0.17,0.21,0.23,0.36,
               0.45,0.05,0.02,0.13,0.27,0.38,0.26,0.38,0.12,0.31,
               0.09,0.40,0.24,0.30,0.21,0.19,0.05,0.30,0.31,0.08),
             byrow = TRUE, nrow = 4)
m2 <- create_motif(m2, alphabet = "DNA", type = "PWM")
m1["motif"]
#>           T         A         T         A         T         A         T
#> A -5.672425  1.978626 -5.672425  1.978626 -5.672425  1.978626 -5.672425
#> C -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425
#> G -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425 -5.672425
#> T  1.978626 -5.672425  1.978626 -5.672425  1.978626 -5.672425  1.978626
#>           A         T         A
#> A  1.978626 -5.672425  1.978626
#> C -5.672425 -5.672425 -5.672425
#> G -5.672425 -5.672425 -5.672425
#> T -5.672425  1.978626 -5.672425
m2["motif"]
#>            S           H           C          N          N          N
#> A -1.3219281  0.09667602 -0.12029423 -0.3959287  0.2141248  0.1491434
#> C  0.5260688  0.19976951  1.02856915  0.6040713 -0.1202942 -0.6582115
#> G  0.8479969 -2.33628339 -3.64385619 -0.9434165  0.1110313  0.5897160
#> T -1.4739312  0.66371661 -0.05889369  0.2630344 -0.2515388 -0.4102840
#>            R          N          N           V
#> A  1.0430687 -1.0732490  0.4436067  0.04222824
#> C -0.5418938 -0.2658941 -0.1202942  0.51171352
#> G  0.0710831  0.5897160 -1.0588937  0.29598483
#> T -2.3074285  0.2486791  0.3103401 -1.65821148

In the first example, sequences which do not have a matching base in every position are punished heavily. The maximum logodds score in this case is approximately 20, and for each incorrect position the score is reduced approximately by 5.7. This means that a threshold of zero would allow for at most three mismatches. At this point, it is up to you how many mismatches you would deem appropriate.

P-values

This thinking becomes impossible for the second example. In this case, mismatches are much less punishing, to the point that one could ask: what even constitutes a mismatch? The answer to this question is usually much more difficult in such cases. An alternative to manually deciding upon a threshold is to instead start with maximum P-value one would consider appropriate for a match. If, say, we want matches with a P-value of at most 0.001, then we can use motif_pvalue() to calculate the appropriate threshold (see the comparisons and P-values vignette for details on motif P-values).

motif_pvalue(m2, pvalue = 0.001)
#> [1] 4.858

Multiple testing-corrected P-values

This P-value can be further refined to correct for multiple testing (and becomes a Q-value). There are three available corrections that can be set in scan_sequences(): Bonferroni (“bonferroni”), Benjamini & Hochberg (“BH”), and the false discovery rate (“fdr”) based on the empirical null distribution of motif hits in a set of sequences. They are excellently explained in Noble (2009), and these explanations will be briefly regurgitated here.

To begin to understand how these different corrections are implemented, consider the following motif, sequences, example P-value for an example motif hit, and the theoretical maximum number of motif hits:

library(universalmotif)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)

(Example.Score <- score_match(ArabidopsisMotif, "TTCTCTTTTTTTTTT"))
#> [1] 16.81
(Example.Pvalue <- motif_pvalue(ArabidopsisMotif, Example.Score))
#> [1] 6.612819e-07

(Max.Possible.Hits <- sum(width(ArabidopsisPromoters) - ncol(ArabidopsisMotif) + 1))
#> [1] 49300

The first correction method, Bonferroni, is by far the simplest. To calculate it, take the P-value of a motif hit and multiply it by the theoretical maximum number of hits:

(Example.bonferroni <- Example.Pvalue * Max.Possible.Hits)
#> [1] 0.0326012

As you can imagine, the level of punishment the P-value receives corresponds to the size of the sequences you are scanning. If you are scanning an entire genome, then you can expect this to be very punishing and only return near-perfect matches (or no matches). However for smaller sets of sequences this correction can be more appropriate.

Next, Benjamini & Hochberg. To perform this correction, the P-value is divided by its fractional rank in the list of P-values for all theoretically possible hits sorted in ascending order (this assumes that P-values are independent and uniformly distributed on [0, 1] under the null hypothesis). It is important to note that this means the correction cannot be calculated before the sequences have been scanned for the motif, and P-values have been calculated for all returned hits. When requesting this type of Q-value for the minimum threshold of score, scan_sequences() instead calculates the threshold from the input Q-value as a P-value, then filters the final results after Q-values have been calculated. Returning to our example:

(Scan.Results <- scan_sequences(ArabidopsisMotif, ArabidopsisPromoters,
  threshold = 0.8, threshold.type = "logodds", calc.qvals = FALSE))
#> DataFrame with 20 rows and 14 columns
#>               motif   motif.i    sequence sequence.i     start      stop
#>         <character> <integer> <character>  <integer> <integer> <integer>
#> 1   YTTTYTTTTTYTTTY         1   AT1G05670         47        68        82
#> 2   YTTTYTTTTTYTTTY         1   AT1G19510         45       402       416
#> 3   YTTTYTTTTTYTTTY         1   AT1G49840         27       899       913
#> 4   YTTTYTTTTTYTTTY         1   AT2G22500         14       946       960
#> 5   YTTTYTTTTTYTTTY         1   AT2G22500         14       948       962
#> ...             ...       ...         ...        ...       ...       ...
#> 16  YTTTYTTTTTYTTTY         1   AT3G23170         34       603       617
#> 17  YTTTYTTTTTYTTTY         1   AT4G19520          3       792       806
#> 18  YTTTYTTTTTYTTTY         1   AT4G19520          3       793       807
#> 19  YTTTYTTTTTYTTTY         1   AT4G27652         20       879       893
#> 20  YTTTYTTTTTYTTTY         1   AT4G27652         20       881       895
#>         score           match thresh.score min.score max.score score.pct
#>     <numeric>     <character>    <numeric> <numeric> <numeric> <numeric>
#> 1      15.407 GTTTCTTTTTTCTTT      15.0272   -125.07    18.784   82.0219
#> 2      17.405 TTTTCTTTTTCTTTT      15.0272   -125.07    18.784   92.6586
#> 3      15.177 CTTTTTGTTTTTTTC      15.0272   -125.07    18.784   80.7975
#> 4      15.827 TCCTCTCTTTCTCTC      15.0272   -125.07    18.784   84.2579
#> 5      15.908 CTCTCTTTCTCTCTT      15.0272   -125.07    18.784   84.6891
#> ...       ...             ...          ...       ...       ...       ...
#> 16     15.734 GTTTCTTCTTTTTTT      15.0272   -125.07    18.784   83.7628
#> 17     15.352 TTTTTTTTTTTTTTT      15.0272   -125.07    18.784   81.7291
#> 18     15.352 TTTTTTTTTTTTTTT      15.0272   -125.07    18.784   81.7291
#> 19     16.410 TTTTCTCTTTTTTTT      15.0272   -125.07    18.784   87.3616
#> 20     16.810 TTCTCTTTTTTTTTT      15.0272   -125.07    18.784   89.4911
#>          strand      pvalue
#>     <character>   <numeric>
#> 1             + 3.95595e-06
#> 2             + 2.44369e-07
#> 3             + 5.01977e-06
#> 4             + 2.53853e-06
#> 5             + 2.39165e-06
#> ...         ...         ...
#> 16            + 2.83419e-06
#> 17            + 4.33848e-06
#> 18            + 4.33848e-06
#> 19            + 1.23950e-06
#> 20            + 6.61282e-07

First we sort and calculate the fractional ranks of our P-values, and then divide the P-values:

Pvalues <- Scan.Results$pvalue
Pvalues.Ranks <- rank(Pvalues) / Max.Possible.Hits
Qvalues.BH <- Pvalues / Pvalues.Ranks
(Example.BH <- Qvalues.BH[Scan.Results$match == "TTCTCTTTTTTTTTT"][1])
#> [1] 0.00652024

Finally, calculating the false discovery rate from the empirical distribution of scores. This method requires some additional steps, as we must obtain the observed and null distributions of hits in our sequences. Then for each hit, divide the number of hits with a score equal to or greater in the null distribution with the number of hits with a score equal to or greater in the observed distribution. Along the way we must be wary of the nonmonotonicity of the final Q-values (meaning that as scores get smaller the Q-value does not always increase), and thus always select the minimum available Q-value as the score increases. To get the null distribution of hits, we can simply use the P-values associated with each score as these are analytically calculated from the null based on the background probabilities (see ?motif_pvalue).

Scan.Results <- Scan.Results[order(Scan.Results$score, decreasing = TRUE), ]
Observed.Hits <- 1:nrow(Scan.Results)
Null.Hits <- Max.Possible.Hits * Scan.Results$pvalue
Qvalues.fdr <- Null.Hits / Observed.Hits
Qvalues.fdr <- rev(cummin(rev(Qvalues.fdr)))
(Example.fdr <- Qvalues.fdr[Scan.Results$match == "TTCTCTTTTTTTTTT"][1])
#> [1] 0.00652024

Similarly to Benjamini & Hochberg, these can only be known after scanning has occurred.

To summarize, we can compare the initial P-value with the different corrections:

knitr::kable(
  data.frame(
    What = c("Score", "P-value", "bonferroni", "BH", "fdr"),
    Value = format(
      c(Example.Score, Example.Pvalue, Example.bonferroni, Example.BH, Example.fdr),
      scientific = FALSE
    )
  ),
  format = "markdown", caption = "Comparing P-value correction methods"
)
Comparing P-value correction methods
What Value
Score 16.8100000000000
P-value 0.0000006612819
bonferroni 0.0326011986749
BH 0.0065202397350
fdr 0.0065202397350

Use your best judgement as to which method is most appropriate for your specific use case.

Regular and higher order scanning

Furthermore, the scan_sequences() function offers the ability to scan using the multifreq slot, if available. This allows to take into account inter-positional dependencies, and get matches which more faithfully represent the original sequences from which the motif originated.

library(universalmotif)
library(Biostrings)
data(ArabidopsisPromoters)

## A 2-letter example:

motif.k2 <- create_motif("CWWWWCC", nsites = 6)
sequences.k2 <- DNAStringSet(rep(c("CAAAACC", "CTTTTCC"), 3))
motif.k2 <- add_multifreq(motif.k2, sequences.k2)

Regular scanning:

scan_sequences(motif.k2, ArabidopsisPromoters, RC = TRUE,
               threshold = 0.9, threshold.type = "logodds")
#> DataFrame with 94 rows and 15 columns
#>           motif   motif.i    sequence sequence.i     start      stop     score
#>     <character> <integer> <character>  <integer> <integer> <integer> <numeric>
#> 1         motif         1   AT1G03850          4       203       209      9.08
#> 2         motif         1   AT1G03850          4       334       328      9.08
#> 3         motif         1   AT1G03850          4       713       707      9.08
#> 4         motif         1   AT1G05670         47       706       700      9.08
#> 5         motif         1   AT1G06160         48       498       492      9.08
#> ...         ...       ...         ...        ...       ...       ...       ...
#> 90        motif         1   AT5G22690         46        81        87      9.08
#> 91        motif         1   AT5G22690         46       362       368      9.08
#> 92        motif         1   AT5G24660         49       146       140      9.08
#> 93        motif         1   AT5G58430         16       332       338      9.08
#> 94        motif         1   AT5G58430         16       343       349      9.08
#>           match thresh.score min.score max.score score.pct      strand
#>     <character>    <numeric> <numeric> <numeric> <numeric> <character>
#> 1       CTAATCC        8.172   -19.649      9.08       100           +
#> 2       CTTTTCC        8.172   -19.649      9.08       100           -
#> 3       CTTAACC        8.172   -19.649      9.08       100           -
#> 4       CTTTACC        8.172   -19.649      9.08       100           -
#> 5       CTAAACC        8.172   -19.649      9.08       100           -
#> ...         ...          ...       ...       ...       ...         ...
#> 90      CAATACC        8.172   -19.649      9.08       100           +
#> 91      CAAATCC        8.172   -19.649      9.08       100           +
#> 92      CATTACC        8.172   -19.649      9.08       100           -
#> 93      CATAACC        8.172   -19.649      9.08       100           +
#> 94      CAAATCC        8.172   -19.649      9.08       100           +
#>          pvalue    qvalue
#>       <numeric> <numeric>
#> 1   0.000976562         1
#> 2   0.000976562         1
#> 3   0.000976562         1
#> 4   0.000976562         1
#> 5   0.000976562         1
#> ...         ...       ...
#> 90  0.000976562         1
#> 91  0.000976562         1
#> 92  0.000976562         1
#> 93  0.000976562         1
#> 94  0.000976562         1

Using 2-letter information to scan:

scan_sequences(motif.k2, ArabidopsisPromoters, use.freq = 2, RC = TRUE,
               threshold = 0.9, threshold.type = "logodds")
#> DataFrame with 8 rows and 15 columns
#>         motif   motif.i    sequence sequence.i     start      stop     score
#>   <character> <integer> <character>  <integer> <integer> <integer> <numeric>
#> 1       motif         1   AT1G19510         45       960       965    17.827
#> 2       motif         1   AT1G49840         27       959       964    17.827
#> 3       motif         1   AT1G77210         32       184       189    17.827
#> 4       motif         1   AT1G77210         32       954       959    17.827
#> 5       motif         1   AT2G37950         15       751       756    17.827
#> 6       motif         1   AT3G57640         33       917       922    17.827
#> 7       motif         1   AT4G12690         12       938       943    17.827
#> 8       motif         1   AT4G14365         35       977       982    17.827
#>         match thresh.score min.score max.score score.pct      strand
#>   <character>    <numeric> <numeric> <numeric> <numeric> <character>
#> 1      CTTTTC      16.0443   -16.842    17.827       100           +
#> 2      CTTTTC      16.0443   -16.842    17.827       100           +
#> 3      CAAAAC      16.0443   -16.842    17.827       100           +
#> 4      CAAAAC      16.0443   -16.842    17.827       100           +
#> 5      CAAAAC      16.0443   -16.842    17.827       100           +
#> 6      CTTTTC      16.0443   -16.842    17.827       100           +
#> 7      CAAAAC      16.0443   -16.842    17.827       100           +
#> 8      CTTTTC      16.0443   -16.842    17.827       100           +
#>        pvalue    qvalue
#>     <numeric> <numeric>
#> 1 1.90735e-06 0.0236988
#> 2 1.90735e-06 0.0236988
#> 3 1.90735e-06 0.0236988
#> 4 1.90735e-06 0.0236988
#> 5 1.90735e-06 0.0236988
#> 6 1.90735e-06 0.0236988
#> 7 1.90735e-06 0.0236988
#> 8 1.90735e-06 0.0236988

Furthermore, sequence scanning can be further refined to avoid overlapping hits. Consider:

motif <- create_motif("AAAAAA")

## Leave in overlapping hits:

scan_sequences(motif, ArabidopsisPromoters, RC = TRUE, threshold = 0.9,
               threshold.type = "logodds")
#> DataFrame with 491 rows and 15 columns
#>           motif   motif.i    sequence sequence.i     start      stop     score
#>     <character> <integer> <character>  <integer> <integer> <integer> <numeric>
#> 1         motif         1   AT1G03850          4        56        51    11.934
#> 2         motif         1   AT1G03850          4        57        52    11.934
#> 3         motif         1   AT1G03850          4        58        53    11.934
#> 4         motif         1   AT1G03850          4        59        54    11.934
#> 5         motif         1   AT1G03850          4       243       248    11.934
#> ...         ...       ...         ...        ...       ...       ...       ...
#> 487       motif         1   AT5G64310         22       589       594    11.934
#> 488       motif         1   AT5G64310         22       590       595    11.934
#> 489       motif         1   AT5G64310         22       591       596    11.934
#> 490       motif         1   AT5G64310         22       592       597    11.934
#> 491       motif         1   AT5G64310         22       696       701    11.934
#>           match thresh.score min.score max.score score.pct      strand
#>     <character>    <numeric> <numeric> <numeric> <numeric> <character>
#> 1        AAAAAA      10.7406   -39.948    11.934       100           -
#> 2        AAAAAA      10.7406   -39.948    11.934       100           -
#> 3        AAAAAA      10.7406   -39.948    11.934       100           -
#> 4        AAAAAA      10.7406   -39.948    11.934       100           -
#> 5        AAAAAA      10.7406   -39.948    11.934       100           +
#> ...         ...          ...       ...       ...       ...         ...
#> 487      AAAAAA      10.7406   -39.948    11.934       100           +
#> 488      AAAAAA      10.7406   -39.948    11.934       100           +
#> 489      AAAAAA      10.7406   -39.948    11.934       100           +
#> 490      AAAAAA      10.7406   -39.948    11.934       100           +
#> 491      AAAAAA      10.7406   -39.948    11.934       100           +
#>          pvalue    qvalue
#>       <numeric> <numeric>
#> 1   0.000244141 0.0494745
#> 2   0.000244141 0.0494745
#> 3   0.000244141 0.0494745
#> 4   0.000244141 0.0494745
#> 5   0.000244141 0.0494745
#> ...         ...       ...
#> 487 0.000244141 0.0494745
#> 488 0.000244141 0.0494745
#> 489 0.000244141 0.0494745
#> 490 0.000244141 0.0494745
#> 491 0.000244141 0.0494745

## Only keep the highest scoring hit amongst overlapping hits:

scan_sequences(motif, ArabidopsisPromoters, RC = TRUE, threshold = 0.9,
               threshold.type = "logodds", no.overlaps = TRUE)
#> DataFrame with 220 rows and 15 columns
#>           motif   motif.i    sequence sequence.i     start      stop     score
#>     <character> <integer> <character>  <integer> <integer> <integer> <numeric>
#> 1         motif         1   AT1G03850          4        56        51    11.934
#> 2         motif         1   AT1G03850          4       243       248    11.934
#> 3         motif         1   AT1G03850          4       735       740    11.934
#> 4         motif         1   AT1G05670         47        32        27    11.934
#> 5         motif         1   AT1G05670         47        78        73    11.934
#> ...         ...       ...         ...        ...       ...       ...       ...
#> 216       motif         1   AT5G64310         22       251       246    11.934
#> 217       motif         1   AT5G64310         22       342       347    11.934
#> 218       motif         1   AT5G64310         22       586       591    11.934
#> 219       motif         1   AT5G64310         22       592       597    11.934
#> 220       motif         1   AT5G64310         22       696       701    11.934
#>           match thresh.score min.score max.score score.pct      strand
#>     <character>    <numeric> <numeric> <numeric> <numeric> <character>
#> 1        AAAAAA      10.7406   -39.948    11.934       100           -
#> 2        AAAAAA      10.7406   -39.948    11.934       100           +
#> 3        AAAAAA      10.7406   -39.948    11.934       100           +
#> 4        AAAAAA      10.7406   -39.948    11.934       100           -
#> 5        AAAAAA      10.7406   -39.948    11.934       100           -
#> ...         ...          ...       ...       ...       ...         ...
#> 216      AAAAAA      10.7406   -39.948    11.934       100           -
#> 217      AAAAAA      10.7406   -39.948    11.934       100           +
#> 218      AAAAAA      10.7406   -39.948    11.934       100           +
#> 219      AAAAAA      10.7406   -39.948    11.934       100           +
#> 220      AAAAAA      10.7406   -39.948    11.934       100           +
#>          pvalue    qvalue
#>       <numeric> <numeric>
#> 1   0.000244141 0.0494745
#> 2   0.000244141 0.0494745
#> 3   0.000244141 0.0494745
#> 4   0.000244141 0.0494745
#> 5   0.000244141 0.0494745
#> ...         ...       ...
#> 216 0.000244141 0.0494745
#> 217 0.000244141 0.0494745
#> 218 0.000244141 0.0494745
#> 219 0.000244141 0.0494745
#> 220 0.000244141 0.0494745

Finally, the results can be returned as a GRanges object for further manipulation:

scan_sequences(motif.k2, ArabidopsisPromoters, RC = TRUE,
               threshold = 0.9, threshold.type = "logodds",
               return.granges = TRUE)
#> GRanges object with 94 ranges and 11 metadata columns:
#>         seqnames    ranges strand |       motif   motif.i sequence.i     score
#>            <Rle> <IRanges>  <Rle> | <character> <integer>  <integer> <numeric>
#>    [1] AT1G03850   203-209      + |       motif         1          4      9.08
#>    [2] AT1G03850   328-334      - |       motif         1          4      9.08
#>    [3] AT1G03850   707-713      - |       motif         1          4      9.08
#>    [4] AT1G05670   700-706      - |       motif         1         47      9.08
#>    [5] AT1G06160   956-962      + |       motif         1         48      9.08
#>    ...       ...       ...    ... .         ...       ...        ...       ...
#>   [90] AT5G22690   362-368      + |       motif         1         46      9.08
#>   [91] AT5G22690     52-58      - |       motif         1         46      9.08
#>   [92] AT5G24660   140-146      - |       motif         1         49      9.08
#>   [93] AT5G58430   332-338      + |       motif         1         16      9.08
#>   [94] AT5G58430   343-349      + |       motif         1         16      9.08
#>              match thresh.score min.score max.score score.pct      pvalue
#>        <character>    <numeric> <numeric> <numeric> <numeric>   <numeric>
#>    [1]     CTAATCC        8.172   -19.649      9.08       100 0.000976562
#>    [2]     CTTTTCC        8.172   -19.649      9.08       100 0.000976562
#>    [3]     CTTAACC        8.172   -19.649      9.08       100 0.000976562
#>    [4]     CTTTACC        8.172   -19.649      9.08       100 0.000976562
#>    [5]     CTAATCC        8.172   -19.649      9.08       100 0.000976562
#>    ...         ...          ...       ...       ...       ...         ...
#>   [90]     CAAATCC        8.172   -19.649      9.08       100 0.000976562
#>   [91]     CATTACC        8.172   -19.649      9.08       100 0.000976562
#>   [92]     CATTACC        8.172   -19.649      9.08       100 0.000976562
#>   [93]     CATAACC        8.172   -19.649      9.08       100 0.000976562
#>   [94]     CAAATCC        8.172   -19.649      9.08       100 0.000976562
#>           qvalue
#>        <numeric>
#>    [1]         1
#>    [2]         1
#>    [3]         1
#>    [4]         1
#>    [5]         1
#>    ...       ...
#>   [90]         1
#>   [91]         1
#>   [92]         1
#>   [93]         1
#>   [94]         1
#>   -------
#>   seqinfo: 50 sequences from an unspecified genome

Visualizing motif hits across sequences

A few suggestions for different ways of plotting hits across sequences are presented here.

Using the ggbio package, it is rather trivial to generate nice visualizations of the output of scan_sequences(). This requires having the GenomicRanges and ggbio packages installed, and outputting the scan_sequences() result as a GRanges object (via return.granges = TRUE).

library(universalmotif)
library(GenomicRanges)
library(ggbio)

data(ArabidopsisPromoters)

motif1 <- create_motif("AAAAAA", name = "Motif A")
motif2 <- create_motif("CWWWWCC", name = "Motif B")

res <- scan_sequences(c(motif1, motif2), ArabidopsisPromoters[1:10],
  return.granges = TRUE, calc.pvals = TRUE, no.overlaps = TRUE,
  threshold = 0.2, threshold.type = "logodds")

## Just plot the motif hits:
autoplot(res, layout = "karyogram", aes(fill = motif, color = motif)) +
  theme(
    strip.background = element_rect(fill = NA, colour = NA),
    panel.background = element_rect(fill = NA, colour = NA)
  )
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.


## Plot Motif A hits by P-value:
autoplot(res[res$motif.i == 1, ], layout = "karyogram",
  aes(fill = log10(pvalue), colour = log10(pvalue))) +
  scale_fill_gradient(low = "black", high = "grey75") +
  scale_colour_gradient(low = "black", high = "grey75") +
  theme(
    strip.background = element_rect(fill = NA, colour = NA),
    panel.background = element_rect(fill = NA, colour = NA)
  )
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.
#> Scale for x is already present.
#> Adding another scale for x, which will replace the existing scale.

Alternatively, just a simple heatmap with only ggplot2.

library(universalmotif)
library(ggplot2)

data(ArabidopsisMotif)
data(ArabidopsisPromoters)

res <- scan_sequences(ArabidopsisMotif, ArabidopsisPromoters,
  threshold = 0, threshold.type = "logodds.abs")
res <- suppressWarnings(as.data.frame(res))
res$x <- mapply(function(x, y) mean(c(x, y)), res$start, res$stop)

ggplot(res, aes(x, sequence, fill = score)) +
  scale_fill_viridis_c() +
  scale_x_continuous(expand = c(0, 0)) +
  xlim(0, 1000) +
  xlab(element_blank()) +
  ylab(element_blank()) +
  geom_tile(width = ncol(ArabidopsisMotif)) +
  theme_bw() +
  theme(panel.grid = element_blank(), axis.text.y = element_text(size = 6)) 
#> Warning: `label` cannot be a <ggplot2::element_blank> object.
#> `label` cannot be a <ggplot2::element_blank> object.

Using packages such as ggExtra or ggpubr, one could even plot marginal histogram or density plots above or below to illustrate any motif positional preference within the sequences. (Though keep in mind that the hit coordinates and sequence lengths would need to be normalized if not all sequences were of the same length, as they are here.)

Finally, the distribution of all possible motif scores could be shown as a line plot across the sequences.

library(universalmotif)
library(ggplot2)

data(ArabidopsisMotif)
data(ArabidopsisPromoters)

res <- scan_sequences(ArabidopsisMotif, ArabidopsisPromoters[1:5],
  threshold = -Inf, threshold.type = "logodds.abs")
res <- suppressWarnings(as.data.frame(res))
res$position <- mapply(function(x, y) mean(c(x, y)), res$start, res$stop)

ggplot(res, aes(position, score, colour = score)) +
  geom_line() +
  geom_hline(yintercept = 0, colour = "red", alpha = 0.3) +
  theme_bw() +
  scale_colour_viridis_c() +
  facet_wrap(~sequence, ncol = 1) +
  xlab(element_blank()) +
  ylab(element_blank()) +
  theme(strip.background = element_blank())
#> Warning: `label` cannot be a <ggplot2::element_blank> object.
#> `label` cannot be a <ggplot2::element_blank> object.

Enrichment analyses

The universalmotif package offers the ability to search for enriched motif sites in a set of sequences via enrich_motifs(). There is little complexity to this, as it simply runs scan_sequences() twice: once on a set of target sequences, and once on a set of background sequences. After which the results between the two sequences are collated and run through enrichment tests. The background sequences can be given explicitly, or else enrich_motifs() will create background sequences on its own by using shuffle_sequences() on the target sequences.

Let us consider the following basic example:

library(universalmotif)
data(ArabidopsisMotif)
data(ArabidopsisPromoters)

enrich_motifs(ArabidopsisMotif, ArabidopsisPromoters, shuffle.k = 3,
              threshold = 0.001, RC = TRUE)
#> DataFrame with 1 row and 15 columns
#>             motif   motif.i motif.consensus target.hits target.seq.hits
#>       <character> <integer>     <character>   <integer>       <integer>
#> 1 YTTTYTTTTTYTTTY         1 YTYTYTTYTTYTTTY         244              50
#>   target.seq.count  bkg.hits bkg.seq.hits bkg.seq.count        Pval        Qval
#>          <integer> <integer>    <integer>     <integer>   <numeric>   <numeric>
#> 1               50       135           46            50 1.23587e-08 1.23587e-08
#>          Eval pct.target.seq.hits pct.bkg.seq.hits target.enrichment
#>     <numeric>           <numeric>        <numeric>         <numeric>
#> 1 2.47174e-08                 100               92           1.08696

Here we can see that the motif is significantly enriched in the target sequences. The Pval was calculated by calling stats::fisher.test().

One final point: always keep in mind the threshold parameter, as this will ultimately decide the number of hits found. (A bad threshold can lead to a false negative.)

Fixed and variable-length gapped motifs

universalmotif class motifs can be gapped, which can be used by scan_sequences() and enrich_motifs(). Note that gapped motif support is currently limited to these two functions. All other functions will ignore the gap information, and even discard them in functions such as merge_motifs().

First, obtain the component motifs:

library(universalmotif)
data(ArabidopsisPromoters)

m1 <- create_motif("TTTATAT", name = "PartA")
m2 <- create_motif("GGTTCGA", name = "PartB")

Then, combine them and add the desired gap. In this case, a gap will be added between the two motifs which can range in size from 4-6 bases.

m <- cbind(m1, m2)
m <- add_gap(m, gaploc = ncol(m1), mingap = 4, maxgap = 6)
m
#> 
#>        Motif name:   PartA/PartB
#>          Alphabet:   DNA
#>              Type:   PCM
#>           Strands:   +-
#>          Total IC:   28
#>       Pseudocount:   0
#>         Consensus:   TTTATAT..GGTTCGA
#>      Target sites:   1
#>     Gap locations:   7-8
#>         Gap sizes:   4-6
#> 
#>   T T T A T A T    G G T T C G A
#> A 0 0 0 1 0 1 0 .. 0 0 0 0 0 0 1
#> C 0 0 0 0 0 0 0 .. 0 0 0 0 1 0 0
#> G 0 0 0 0 0 0 0 .. 1 1 0 0 0 1 0
#> T 1 1 1 0 1 0 1 .. 0 0 1 1 0 0 0

Now, it can be used directly in scan_sequences() or enrich_motifs():

scan_sequences(m, ArabidopsisPromoters, threshold = 0.4, threshold.type = "logodds")
#> DataFrame with 75 rows and 15 columns
#>           motif   motif.i    sequence sequence.i     start      stop     score
#>     <character> <integer> <character>  <integer> <integer> <integer> <numeric>
#> 1   PartA/PartB         1   AT1G03850          4       376       394    11.178
#> 2   PartA/PartB         1   AT1G03850          4       414       432    12.168
#> 3   PartA/PartB         1   AT1G06160         48       144       161    11.918
#> 4   PartA/PartB         1   AT1G12990         28        71        90    11.428
#> 5   PartA/PartB         1   AT1G19380          2       226       245    11.428
#> ...         ...       ...         ...        ...       ...       ...       ...
#> 71  PartA/PartB         1   AT5G22690         46       638       656    11.178
#> 72  PartA/PartB         1   AT5G47230         24        91       110    12.418
#> 73  PartA/PartB         1   AT5G47230         24       449       468    11.428
#> 74  PartA/PartB         1   AT5G64310         22       869       888    11.428
#> 75  PartA/PartB         1   AT5G64310         22       909       927    11.178
#>                    match thresh.score min.score max.score score.pct      strand
#>              <character>    <numeric> <numeric> <numeric> <numeric> <character>
#> 1    TATATGT.....GGTGCAA      11.1384   -93.212    27.846   40.1422           +
#> 2    TTGATAT.....TGTTAGA      11.1384   -93.212    27.846   43.6975           +
#> 3     TTTATGT....GGTTTGT      11.1384   -93.212    27.846   42.7997           +
#> 4   GTTATGT......TGTTAGA      11.1384   -93.212    27.846   41.0400           +
#> 5   TTTACAG......CGTTCGT      11.1384   -93.212    27.846   41.0400           +
#> ...                  ...          ...       ...       ...       ...         ...
#> 71   TTCATTT.....GGCTTGA      11.1384   -93.212    27.846   40.1422           +
#> 72  TTTATAC......TGTTCCA      11.1384   -93.212    27.846   44.5953           +
#> 73  TATATGT......GGGTCAA      11.1384   -93.212    27.846   41.0400           +
#> 74  ATAATAT......CGTTAGA      11.1384   -93.212    27.846   41.0400           +
#> 75   TTCATAT.....GTCACGA      11.1384   -93.212    27.846   40.1422           +
#>          pvalue      qvalue
#>       <numeric>   <numeric>
#> 1   1.60187e-07 0.000105403
#> 2   1.60187e-07 0.000105403
#> 3   1.60187e-07 0.000105403
#> 4   1.60187e-07 0.000105403
#> 5   1.60187e-07 0.000105403
#> ...         ...         ...
#> 71  1.60187e-07 0.000105403
#> 72  1.60187e-07 0.000105403
#> 73  1.60187e-07 0.000105403
#> 74  1.60187e-07 0.000105403
#> 75  1.60187e-07 0.000105403

Detecting low complexity regions and sequence masking

Highly-repetitive low complexity regions can oftentimes cause problems during de novo motif discovery, leading to obviously false motifs being returned. One way to get around this issue is to preemptively remove or mask these regions. The universalmotif package includes a few functions which can help carry out this task.

Using mask_seqs(), one can mask a specific pattern of letters in XStringSet objects. Consider the following sequences:

library(universalmotif)
library(Biostrings)

Ex.seq <- DNAStringSet(c(
  A = "GTTGAAAAAAAAAAAAAAAACAGACGT",
  B = "TTAGATGGCCCATAGCTTATACGGCAA",
  C = "AATAAAATGCTTAGGAAATCGATTGCC"
))

We can easily mask portions that contain, say, stretches of at least 8 As:

mask_seqs(Ex.seq, "AAAAAAAA")
#> DNAStringSet object of length 3:
#>     width seq                                               names               
#> [1]    27 GTTG----------------CAGACGT                       A
#> [2]    27 TTAGATGGCCCATAGCTTATACGGCAA                       B
#> [3]    27 AATAAAATGCTTAGGAAATCGATTGCC                       C

Alternatively, instead of masking a know stretch of letters one can find low complexity regions using sequence_complexity(), and then mask specific regions in the sequences using mask_ranges(). The sequence_complexity() function has several complexity metrics available: the Wootton-Federhen (Wootton and Federhen 1993) and Trifonov (Trifonov 1990) algorithms (and their approximations) are well described in Orlov and Potapov (2004), and DUST in Morgulis et al. (2006). See ?sequence_complexity for more details.

(Ex.DUST <- sequence_complexity(Ex.seq, window.size = 10, method = "DUST",
    return.granges = TRUE))
#> GRanges object with 15 ranges and 1 metadata column:
#>        seqnames    ranges strand | complexity
#>           <Rle> <IRanges>  <Rle> |  <numeric>
#>    [1]        A      1-10      * |   0.857143
#>    [2]        A      6-15      * |   4.000000
#>    [3]        A     11-20      * |   4.000000
#>    [4]        A     16-25      * |   0.428571
#>    [5]        A     21-27      * |   0.000000
#>    ...      ...       ...    ... .        ...
#>   [11]        C      1-10      * |   0.285714
#>   [12]        C      6-15      * |   0.000000
#>   [13]        C     11-20      * |   0.000000
#>   [14]        C     16-25      * |   0.000000
#>   [15]        C     21-27      * |   0.000000
#>   -------
#>   seqinfo: 3 sequences from an unspecified genome

Using the DUST algorithm, we can see there are a couple of regions which spike in the complexity score (for this particular algorithm, more complex sequences converge towards zero). Now it is only a matter of filtering for those regions and using mask_ranges().

(Ex.DUST <- Ex.DUST[Ex.DUST$complexity >= 3])
#> GRanges object with 2 ranges and 1 metadata column:
#>       seqnames    ranges strand | complexity
#>          <Rle> <IRanges>  <Rle> |  <numeric>
#>   [1]        A      6-15      * |          4
#>   [2]        A     11-20      * |          4
#>   -------
#>   seqinfo: 3 sequences from an unspecified genome
mask_ranges(Ex.seq, Ex.DUST)
#> DNAStringSet object of length 3:
#>     width seq                                               names               
#> [1]    27 GTTGA---------------CAGACGT                       A
#> [2]    27 TTAGATGGCCCATAGCTTATACGGCAA                       B
#> [3]    27 AATAAAATGCTTAGGAAATCGATTGCC                       C

Now these sequences could be used directly with scan_sequences() or written to a fasta file using Biostrings::writeXStringSet() for use with an external de novo motif discovery program such as MEME.

Motif discovery with MEME

Note: In the time since the inception of the run_meme() function, Spencer Nystrom (a contributor to universalmotif) has created the memes package as a interface to much of the MEME suite. It is fully interoperable with the universalmotif package and provides a much more convenient way to run MEME programs from within R. Install it from Bioconductor with BiocManager::install("memes").

The universalmotif package provides a simple wrapper to the powerful motif discovery tool MEME (Bailey and Elkan 1994). To run an analysis with MEME, all that is required is a set of XStringSet class sequences (defined in the Biostrings package), and run_meme() will take care of running the program and reading the output for use within R.

The first step is to check that R can find the MEME binary in your $PATH by running run_meme() without any parameters. If successful, you should see the default MEME help message in your console. If not, then you’ll need to provide the complete path to the MEME binary. There are two options:

library(universalmotif)

## 1. Once per session: via `options()`

options(meme.bin = "/path/to/meme/bin/meme")

run_meme(...)

## 2. Once per run: via `run_meme()`

run_meme(..., bin = "/path/to/meme/bin/meme")

Now we need to get some sequences to use with run_meme(). At this point we can read sequences from disk or extract them from one of the Bioconductor BSgenome packages.

library(universalmotif)
data(ArabidopsisPromoters)

## 1. Read sequences from disk (in fasta format):

library(Biostrings)

# The following `read*()` functions are available in Biostrings:
# DNA: readDNAStringSet
# DNA with quality scores: readQualityScaledDNAStringSet
# RNA: readRNAStringSet
# Amino acid: readAAStringSet
# Any: readBStringSet

sequences <- readDNAStringSet("/path/to/sequences.fasta")

run_meme(sequences, ...)

## 2. Extract from a `BSgenome` object:

library(GenomicFeatures)
library(TxDb.Athaliana.BioMart.plantsmart28)
library(BSgenome.Athaliana.TAIR.TAIR9)

# Let us retrieve the same promoter sequences from ArabidopsisPromoters:
gene.names <- names(ArabidopsisPromoters)

# First get the transcript coordinates from the relevant `TxDb` object:
transcripts <- transcriptsBy(TxDb.Athaliana.BioMart.plantsmart28,
                             by = "gene")[gene.names]

# There are multiple transcripts per gene, we only care for the first one
# in each:

transcripts <- lapply(transcripts, function(x) x[1])
transcripts <- unlist(GRangesList(transcripts))

# Then the actual sequences:

# Unfortunately this is a case where the chromosome names do not match
# between the two databases

seqlevels(TxDb.Athaliana.BioMart.plantsmart28)
#> [1] "1"  "2"  "3"  "4"  "5"  "Mt" "Pt"
seqlevels(BSgenome.Athaliana.TAIR.TAIR9)
#> [1] "Chr1" "Chr2" "Chr3" "Chr4" "Chr5" "ChrM" "ChrC"

# So we must first rename the chromosomes in `transcripts`:
seqlevels(transcripts) <- seqlevels(BSgenome.Athaliana.TAIR.TAIR9)

# Finally we can extract the sequences
promoters <- getPromoterSeq(transcripts,
                            BSgenome.Athaliana.TAIR.TAIR9,
                            upstream = 1000, downstream = 0)

run_meme(promoters, ...)

Once the sequences are ready, there are few important options to keep in mind. One is whether to conserve the output from MEME. The default is not to, but this can be changed by setting the relevant option:

run_meme(sequences, output = "/path/to/desired/output/folder")

The second important option is the search function (objfun). Some search functions such as the default classic do not require a set of background sequences, whilst some do (such as de). If you choose one of the latter, then you can either let MEME create them for you (it will shuffle the target sequences) or you can provide them via the control.sequences parameter.

Finally, choose how you’d like the data imported into R. Once the MEME program exits, run_meme() will import the results into R with read_meme(). At this point you can decide if you want just the motifs themselves (readsites = FALSE) or if you’d like the original sequence sites as well (readsites = TRUE, the default). Doing the latter gives you the option of generating higher order representations for the imported MEME motifs as shown here:

motifs <- run_meme(sequences)
motifs.k23 <- mapply(add_multifreq, motifs$motifs, motifs$sites)

There are a wealth of other MEME options available, such as the number of desired motifs (nmotifs), the width of desired motifs (minw, maxw), the search mode (mod), assigning sequence weights (weights), using a custom alphabet (alph), and many others. See the output from run_meme() for a brief description of the options, or visit the online manual for more details.

Miscellaneous string utilities

Since biological sequences are usually contained in XStringSet class objects, sequence_complexity(), get_bkg() and shuffle_sequences() are designed to work with such objects. For cases when strings are not XStringSet objects, the following functions are available:

  • calc_complexity(): alternative to sequence_complexity()
  • count_klets(): alternative to get_bkg()
  • shuffle_string(): alternative to shuffle_sequences()
library(universalmotif)

string <- "DASDSDDSASDSSA"

calc_complexity(string)
#> [1] 0.7823323

count_klets(string, 2)
#>   klets counts
#> 1    AA      0
#> 2    AD      0
#> 3    AS      2
#> 4    DA      1
#> 5    DD      1
#> 6    DS      3
#> 7    SA      2
#> 8    SD      3
#> 9    SS      1

shuffle_string(string, 2)
#> [1] "DSDDSASDSDASSA"

A few other utilities have also been made available (based on the internal code of other universalmotif functions) that work on simple character vectors:

  • calc_windows(): calculate the coordinates for sliding windows from 1 to any number n
  • get_klets(): get a list of all possible k-lets for any sequence alphabet
  • slide_fun(): apply a function over sliding windows across a single string
  • window_string(): retrieve characters from sliding windows of a single string
library(universalmotif)

calc_windows(n = 12, window = 4, overlap = 2)
#>   start stop
#> 1     1    4
#> 2     3    6
#> 3     5    8
#> 4     7   10
#> 5     9   12

get_klets(c("A", "S", "D"), 2)
#> [1] "AA" "AS" "AD" "SA" "SS" "SD" "DA" "DS" "DD"

slide_fun("ABCDEFGH", charToRaw, raw(2), window = 2, overlap = 1)
#>      [,1] [,2] [,3] [,4] [,5] [,6] [,7]
#> [1,]   41   42   43   44   45   46   47
#> [2,]   42   43   44   45   46   47   48

window_string("ABCDEFGH", window = 2, overlap = 1)
#> [1] "AB" "BC" "CD" "DE" "EF" "FG" "GH"

Session info

#> R version 4.6.0 (2026-04-24)
#> Platform: x86_64-pc-linux-gnu
#> Running under: Ubuntu 24.04.4 LTS
#> 
#> Matrix products: default
#> BLAS:   /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 
#> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.26.so;  LAPACK version 3.12.0
#> 
#> locale:
#>  [1] LC_CTYPE=en_US.UTF-8       LC_NUMERIC=C              
#>  [3] LC_TIME=en_US.UTF-8        LC_COLLATE=en_US.UTF-8    
#>  [5] LC_MONETARY=en_US.UTF-8    LC_MESSAGES=en_US.UTF-8   
#>  [7] LC_PAPER=en_US.UTF-8       LC_NAME=C                 
#>  [9] LC_ADDRESS=C               LC_TELEPHONE=C            
#> [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C       
#> 
#> time zone: Etc/UTC
#> tzcode source: system (glibc)
#> 
#> attached base packages:
#> [1] stats4    stats     graphics  grDevices utils     datasets  methods  
#> [8] base     
#> 
#> other attached packages:
#>  [1] ggbio_1.60.0          TFBSTools_1.50.0      cowplot_1.2.0        
#>  [4] dplyr_1.2.1           ggtree_4.2.0          ggplot2_4.0.3        
#>  [7] MotifDb_1.54.0        GenomicRanges_1.64.0  Biostrings_2.80.0    
#> [10] Seqinfo_1.2.0         XVector_0.52.0        IRanges_2.46.0       
#> [13] S4Vectors_0.50.0      BiocGenerics_0.58.0   generics_0.1.4       
#> [16] universalmotif_1.30.1 bookdown_0.46        
#> 
#> loaded via a namespace (and not attached):
#>   [1] RColorBrewer_1.1-3          rstudioapi_0.18.0          
#>   [3] sys_3.4.3                   jsonlite_2.0.0             
#>   [5] magrittr_2.0.5              GenomicFeatures_1.64.0     
#>   [7] farver_2.1.2                rmarkdown_2.31             
#>   [9] fs_2.1.0                    BiocIO_1.22.0              
#>  [11] vctrs_0.7.3                 memoise_2.0.1              
#>  [13] Rsamtools_2.28.0            RCurl_1.98-1.18            
#>  [15] base64enc_0.1-6             htmltools_0.5.9            
#>  [17] S4Arrays_1.12.0             curl_7.1.0                 
#>  [19] SparseArray_1.12.2          Formula_1.2-5              
#>  [21] gridGraphics_0.5-1          sass_0.4.10                
#>  [23] bslib_0.10.0                htmlwidgets_1.6.4          
#>  [25] plyr_1.8.9                  cachem_1.1.0               
#>  [27] buildtools_1.0.0            GenomicAlignments_1.48.0   
#>  [29] lifecycle_1.0.5             pkgconfig_2.0.3            
#>  [31] Matrix_1.7-5                R6_2.6.1                   
#>  [33] fastmap_1.2.0               MatrixGenerics_1.24.0      
#>  [35] digest_0.6.39               aplot_0.2.9                
#>  [37] colorspace_2.1-2            TFMPvalue_1.0.0            
#>  [39] OrganismDbi_1.54.0          AnnotationDbi_1.74.0       
#>  [41] patchwork_1.3.2             Hmisc_5.2-5                
#>  [43] RSQLite_2.4.6               seqLogo_1.78.0             
#>  [45] labeling_0.4.3              httr_1.4.8                 
#>  [47] abind_1.4-8                 compiler_4.6.0             
#>  [49] bit64_4.8.0                 fontquiver_0.2.1           
#>  [51] withr_3.0.2                 backports_1.5.1            
#>  [53] htmlTable_2.5.0             S7_0.2.2                   
#>  [55] BiocParallel_1.46.0         DBI_1.3.0                  
#>  [57] MASS_7.3-65                 rappdirs_0.3.4             
#>  [59] DelayedArray_0.38.1         rjson_0.2.23               
#>  [61] gtools_3.9.5                caTools_1.18.3             
#>  [63] tools_4.6.0                 splitstackshape_1.4.8.1    
#>  [65] foreign_0.8-91              ape_5.8-1                  
#>  [67] ggseqlogo_0.2.2             nnet_7.3-20                
#>  [69] glue_1.8.1                  restfulr_0.0.16            
#>  [71] nlme_3.1-169                grid_4.6.0                 
#>  [73] checkmate_2.3.4             cluster_2.1.8.2            
#>  [75] reshape2_1.4.5              ade4_1.7-24                
#>  [77] gtable_0.3.6                BSgenome_1.80.0            
#>  [79] ensembldb_2.36.0            tidyr_1.3.2                
#>  [81] data.table_1.18.2.1         pillar_1.11.1              
#>  [83] stringr_1.6.0               yulab.utils_0.2.4          
#>  [85] treeio_1.36.1               lattice_0.22-9             
#>  [87] rtracklayer_1.72.0          bit_4.6.0                  
#>  [89] biovizBase_1.60.0           RBGL_1.88.0                
#>  [91] tidyselect_1.2.1            DirichletMultinomial_1.54.0
#>  [93] fontLiberation_0.1.0        maketools_1.3.2            
#>  [95] knitr_1.51                  fontBitstreamVera_0.1.1    
#>  [97] gridExtra_2.3               grImport2_0.3-3            
#>  [99] ProtGenerics_1.44.0         SummarizedExperiment_1.42.0
#> [101] xfun_0.57                   Biobase_2.72.0             
#> [103] matrixStats_1.5.0           UCSC.utils_1.8.0           
#> [105] stringi_1.8.7               lazyeval_0.2.3             
#> [107] ggfun_0.2.0                 yaml_2.3.12                
#> [109] evaluate_1.0.5              codetools_0.2-20           
#> [111] cigarillo_1.2.0             gdtools_0.5.0              
#> [113] tibble_3.3.1                graph_1.90.0               
#> [115] BiocManager_1.30.27         ggplotify_0.1.3            
#> [117] cli_3.6.6                   rpart_4.1.27               
#> [119] systemfonts_1.3.2           jquerylib_0.1.4            
#> [121] GenomeInfoDb_1.48.0         dichromat_2.0-0.1          
#> [123] Rcpp_1.1.1-1.1              png_0.1-9                  
#> [125] XML_3.99-0.23               parallel_4.6.0             
#> [127] blob_1.3.0                  jpeg_0.1-11                
#> [129] AnnotationFilter_1.36.0     bitops_1.0-9               
#> [131] pwalign_1.8.0               viridisLite_0.4.3          
#> [133] tidytree_0.4.7              VariantAnnotation_1.58.0   
#> [135] ggiraph_0.9.6               scales_1.4.0               
#> [137] motifStack_1.56.0           purrr_1.2.2                
#> [139] crayon_1.5.3                rlang_1.2.0                
#> [141] KEGGREST_1.52.0

References

Altschul, Stephen F., and Bruce W. Erickson. 1985. “Significance of Nucleotide Sequence Alignments: A Method for Random Sequence Permutation That Preserves Dinucleotide and Codon Usage.” Molecular Biology and Evolution 2: 526–38.
Bailey, T. L., and C. Elkan. 1994. “Fitting a Mixture Model by Expectation Maximization to Discover Motifs in Biopolymers.” Proceedings of the Second International Conference on Intelligent Systems for Molecular Biology 2: 28–36.
Fitch, Walter M. 1983. “Random Sequences.” Journal of Molecular Biology 163: 171–76.
Jiang, M., J. Anderson, J. Gillespie, and M. Mayne. 2008. “uShuffle: A Useful Tool for Shuffling Biological Sequences While Preserving k-Let Counts.” BMC Bioinformatics 9.
Morgulis, A., E. M. Gertz, A. A. Schaffer, and R. Agarwala. 2006. “A Fast and Symmetric DUST Implementation to Mask Low-Complexity DNA Sequences.” Journal of Computational Biology 13: 1028–40.
Noble, William S. 2009. “How Does Multiple Testing Correction Work?” Nature Biotechnology 27: 1135–37.
Orlov, Y. L., and V. N. Potapov. 2004. “Complexity: An Internet Resource for Analysis of DNA Sequence Complexity.” Nucleic Acids Research 32: W628–33.
Propp, J. G., and D. W. Wilson. 1998. “How to Get a Perfectly Random Sample from a Generic Markov Chain and Generate a Random Spanning Tree of a Directed Graph.” Journal of Algorithms 27: 170–217.
Trifonov, E. N. 1990. “Making Sense of the Human Genome.” In Structure & Methods, edited by R. H. Sarma. Adenine Press.
Wootton, J. C., and S. Federhen. 1993. “Statistics of Local Complexity in Amino Acid Sequences and Sequence Databases.” Computers & Chemistry 17: 149–63.